SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPMAP00000009639 from Petromyzon marinus 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPMAP00000009639
Domain Number 1 Region: 332-458
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-22
Family Ran-binding domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPMAP00000009639   Gene: ENSPMAG00000008748   Transcript: ENSPMAT00000009680
Sequence length 462
Comment pep:putative scaffold:Pmarinus_7.0:GL486381:4157:8047:-1 gene:ENSPMAG00000008748 transcript:ENSPMAT00000009680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIADRELNDRNWNDEDDVEEAGSFSVANEDVLKGRAIKKARRRVGGDTSESAKTTFK
GFGGLVTSSASGFGSLSSGFGGFKPLAGLANGSTVASSALPTTPSMSAATNTQTALAQAA
GKGSPKTGSSTADASQSTALAYSSHSDHSGSGSEKGTYNHQLRSLNYSVRDWIVKHVNGN
PLCDLTPVFRDYERHLADIDQKYSGESGSDSDGAAKLSRNAESPKAAPLSFQGLQAANAT
AGSTTASNSRQSSAASFAISGKSAAPLAGSATFSFVKTSAKAPFGTASATGNPALPTFTF
TNAGFGSSPAVPGFSFSASSVQKPLAQESEEQDGEDEEPPKPVVNEVKESDAFYSTKCKL
FYKKGEEFKEKGVGMLHLKPMENKKTQLLIRADTSLGNILLNVLLQPSMVCTRTGKNVLL
MCVPNPPVDEGSKDAVVPMLIRVKTGEDADELHRAIGDKKGS
Download sequence
Identical sequences S4RWP9
ENSPMAP00000009639 ENSPMAP00000009639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]