SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.model.contig_2020.16 from Porphyridium purpureum 02_2012

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.model.contig_2020.16
Domain Number 1 Region: 382-751
Classification Level Classification E-value
Superfamily SIS domain 3.43e-85
Family double-SIS domain 0.000000905
Further Details:      
 
Domain Number 2 Region: 2-47,112-253,305-349
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.68e-48
Family Class II glutamine amidotransferases 0.0000829
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.model.contig_2020.16
Sequence length 752
Sequence
MCGIFACFIHGSDTLSEREVAGVLLNGLGRLEYRGYDSAGLCLSRSSTCVCSSEQPAVQD
QFCPRLLKTVGTVSVLRELVDREMSPGSVNGANGRRAKCTDDSRRGSCAVGQRCGTTHVG
IAHTRWATHGAVSVENCHPHVSSAELEFVVVHNGIITNYQALKEMLLKKGTRFESDTDTE
VVVKLIHYLYSTLLEAPSESSRKTASASIPFEKLVMHLMRHLEGAFALIFLSTKYPGQIV
ACKRGSPLVIGLKGEYNVSERTKGGHFSKTDSAARITSSKLSKGATASLSLGRTRNLDSE
GRGHDELNDSTQYFFASDVNAIVEHTDRVLYTEDNDIVSVRSGELQVFNVTSEFSYENED
EQMVVPNRQVSTIQMELHEIMKGSFPHFMKKEIFEQPESIKQTMRGRILNGSEVHLTGVR
EHMSDIRKSTRLIFVASGTSYNACMASRQILEELSEIPVIVELAGDFMDRLCPIFRSDVV
AFVSQSGETADTLDALKYARKHGAMCMGIVNVVGSSISRLTDFGVHLNAGSEIGVASTKV
YTSQIVVMVMIALELSADSKNKSARRIAILQGLRELSANIEKTILLVDEHVQRIADQLAD
DRSILCFGRGYHYATCVEAALKIKEVAYIHTEGINAGELKHGPIALVDENLPIVVFSSMD
LTAVKVQSAIHQLLARGVRQRLIVVCSESDTQMLELVASREGVDVIKVAHTVDCLQSVLS
IIPMQLLSYYLAVARKLNVDCPRNLAKSVTVH
Download sequence
Identical sequences evm.model.contig_2020.16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]