SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.model.contig_2062.10 from Porphyridium purpureum 02_2012

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.model.contig_2062.10
Domain Number 1 Region: 30-557
Classification Level Classification E-value
Superfamily SIS domain 1.47e-180
Family Phosphoglucose isomerase, PGI 0.000000000568
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) evm.model.contig_2062.10
Sequence length 558
Sequence
MATATVAKTAAGTAMEECVVSLYAEVGSIQETHLRELLQDEERCAAMVAEHNGLMLDYSR
QRVSMDTRERLLELAKAAQLSARINSMMSGEKINPTEGRAVLHTALRAARDDKVVLDGVD
VVADVYSVLDKIQAFSESVRSGDHKGHTGKALTDVVAVGIGGSYLGPEFVYEALRYDAEA
RAGASGRKLRFLANVDPVDVARATEGLDPSTTLVVIVSKTFTTAETMLNARTMRKWITDS
LGTDAIAKHMIAVSTNIKLVSEFGIDPENAFGFWDWVGGRFSVCSAVGVMPLALQYGFDV
VRKFLDGARDMDRHFATAPYEQNIPVLLGLMGVWNSTFLGHATRALLPYQQALLKLAPHI
QQVDMESNGKRVRLDGSELPHASGPINFGEPGTNGQHSFYQLMHQGRVVPADFVGVIKSQ
NPIELENESVSNHDELMSNFFAQPDALACGKTAEEVRAEGVPEELVPHKVFPGNRPSSSL
LIDELTAFSLGQLLAVFEHRTTVEGFIWNINSFDQWGVELGKVLAKQVRTQLSDSRKNCA
AVEGFNSSTARMLKKYLQ
Download sequence
Identical sequences evm.model.contig_2062.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]