SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.model.contig_4465.13 from Porphyridium purpureum 02_2012

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  evm.model.contig_4465.13
Domain Number - Region: 919-1021
Classification Level Classification E-value
Superfamily SIS domain 0.000156
Family double-SIS domain 0.096
Further Details:      
 
Domain Number - Region: 297-315,345-436
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0334
Family Class II glutamine amidotransferases 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) evm.model.contig_4465.13
Sequence length 1321
Sequence
MACSVLSSCEQGGVFSKWRSAWFTVCTSENLTAHKPLRWWAQTLVFWARPLFPTEPELPH
VMVATGRYASTIRLAGPAGSLSLSVAAAVALLIQISRGAQWGRDQNAILWFTRCVFAVSL
WTSLDALVSDVCMQPHHTLGEKERCHGLSSNVEQHSVFFCGNFGALVYWQASRSSRHFLD
MVRSMIAVTMLRGGQAGGAVMYVPDAAQPGSMRAVRSRLVNSKRGRLDYKIVRALRWRLA
LWTLWLKLRRAFAWLTGGLGKRPWRGGAGNGQAEDAELSPGLEDASQGRRSVVLLQGHTR
FATSSLLKTRETHPHTWGGREMKRVWVRSCTPGGLYVQVTQNVQNFITHNGDFDFCELFH
EDQSVRVVHRWLEMVLGVPNAGTGDSVNIAGLFDLVRTQGLWYESVRLAYCMFVLKSISD
VPDFDTMRKVAAVFEREFKAWNDNMLMRSNKPRAARSATGGPDGLEVSMDDVGIDLTIEI
SALDLMLLISNFGRGLGEQCPEIESEVANALCTASVDYFFRNSTRKAMEWFLERAKGSFG
IAVSNSMRRDEIVLAAHGQPMFIGWNGSQSGMECDNTSECMDTVLYGSEVHALEVALLGA
GAPGTHQRLTKYFQLADTHGEVFQIARRPDEFEAEARVLCMIEDGHAVKLMYNLRRALHH
SSKAKGMADAALEDDGGSMNPKKKQVSNGHQMHPKGSDGSDGSTTDDIPADYGNTLIHLP
GSPFLFRAFSLESGAYLTETELLLRTHPFVHQTPSDDDASGSSEKHRTKGTWGQDDVWQD
LQDLPGVLKRIESDWDSSAAKAAHSSGGVDLEPPTAVKSAVSNGSVIRELGHAFAALADN
HALYQYSTRGLERGLDVLVVGVEVSLWISEQFVADLEVAFPKIRARAWSANKVLGALGTF
RDPSGPLGFAHGELPNLTFSMNKKGIVLLVSQSGVTFPTYHAAKILEKAFASRVFVLTSD
RTNLISQVVHHRADRVILNHAGARPAEPSSVALVAAHHSLTRVLELFMATAFVRYGGKHD
RPFGMAFGASDLQTMRDTRAAFVQNCATYCDAGSDVYAQLKAAGRHFGNHILEPFVSVVL
GTIYILVTVGFTGAPASELAKHICGRSLCNANAQRYVAGVVDAVLYIFLPWWTAMLFRLV
TRRDMLARLGKRTLVICDMPWVHQALEMYVSKLFALAYGWMSVDVHGANALDHFVHRFTH
RVTRGVMLAVGRPDGRLISLTAREAQCLMAALQAKCVQHLRSGPDLITVGHNSYKPSVLE
RDISVALPTQRKMFMCERMLEIDPAIGMEAKGGTLVPVDSGSGARTGSPMTNVHEIMSKQ
E
Download sequence
Identical sequences evm.model.contig_4465.13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]