SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for evm.model.contig_2504.5 from Porphyridium purpureum 02_2012

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  evm.model.contig_2504.5
Domain Number 1 Region: 15-200
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 6.98e-38
Family PAPS reductase-like 0.0066
Further Details:      
 
Domain Number 2 Region: 256-346
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.11e-22
Family Thioltransferase 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) evm.model.contig_2504.5
Sequence length 353
Sequence
MSDDWNTLGAKWSKERADPVEVMDKALESFGKDAAIAFSGAEDVVLIEYAQRTGRPFRVF
ALETGRLHAETLRYYAEVEKHYGIRIEYCYGDAGEVEALVNEKGLFSFYEDGHQECCRVR
KVRPLRKKLGTLKAWITGQRKDQSPGTRTEVPMCQVDPAFRGANDSDLIKFNPLANTSSA
DVWSMIRIVEIPYNPLHLRGFTSIGCEPCTKPVLPNQHEREGRWWWEEATQKECGLHKGN
ISQDAVALERADNDLRDKIASSSIVMFSKSGCPFCEEVRQIFTKLAVPYTEYKVEDSPDL
IAALERLTKQSTVPNVFIQKRHLGTAENMKRMYADGELAKILNEAGLKLSSVA
Download sequence
Identical sequences evm.model.contig_2504.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]