SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_10430577g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MA_10430577g0010
Domain Number - Region: 28-114
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00591
Family RecA protein-like (ATPase-domain) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_10430577g0010
Sequence length 170
Comment high_confidence
Sequence
MLHPDYTGGKVTKTENALFELYKSIHQNLQECISSKRKRGGVCIMIDDLSLLEIVAHGSE
GHVLDFLHYCRVLTSEQGCSLVLLSHQDIYASMDNSSFIRHLEYFADIVIDVEPLNSGLS
ADVHGQLTVFHRSSQEDISDMGSGPRNLLHNFHFRVKENQVEYFLPGKQI
Download sequence
Identical sequences MA_10430577g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]