SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_10435486g0020 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10435486g0020
Domain Number 1 Region: 6-79
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000204
Family G proteins 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_10435486g0020
Sequence length 208
Comment high_confidence
Sequence
MLQTQNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQSR
SLRRAQDVRKQLLAIMDRYKLDVMSAGKNFTKIRKAIAAGFFFHAARKDPQEGYRTLVEN
QPVYIHPSSALFQRQPDWVIYYELVMTTKEYMREVTVVDPKWLVELAPRFFKVADPTKLS
KRKRQERIEPLYDRYHEPNSWRLSKRRA
Download sequence
Identical sequences MA_10435486g0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]