SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_175090g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_175090g0010
Domain Number 1 Region: 248-343
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-18
Family B3 DNA binding domain 0.012
Further Details:      
 
Weak hits

Sequence:  MA_175090g0010
Domain Number - Region: 13-67
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00647
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_175090g0010
Sequence length 344
Comment high_confidence
Sequence
MPAVIGAVFTSPLHEVPSDCFKQSRIKGSRDAILEGPSGHLWHPKDIIVFRHANDAHFLV
QIFEASGYEKKSTVTVKIYESHNFHKRGSYCTEATTFGQTVKENPLKDASGDVKNVQKIS
TRNAQRRTTRSRGLKVEISGNCAEACISNSRPLSIKKHEFLGHPKISVKHELGLPKSKWN
FSESQVGSCAKHPIILDSEEEFDSQASSADSPDQDTYEVSYHSSSEVLQEKVSSLIEEDK
TANSVKKGKPKFTQVMKKSAVSNSFWLGVPHSFGRCWFPRGNVEVLLLHQRHKWRVLFVG
ERSSCGLGPGWKYFAVDNELKIGDTCIFELEDKVNYILKVHIRR
Download sequence
Identical sequences MA_175090g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]