SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_60257g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_60257g0010
Domain Number 1 Region: 84-240
Classification Level Classification E-value
Superfamily IpsF-like 3.79e-57
Family IpsF-like 0.00000959
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_60257g0010
Sequence length 241
Comment high_confidence
Sequence
MAAFTTLTAFTLPKSTRHPASQAAFCAPVWKPTNFKAAGAHSISIRGQFLASVLKHEVIS
EVSASTVIGTETRGGSAKPAAVLPFRIGHGFDLHRLEPNLPLIIGGINIPHDRGCEAHSD
GDVLLHCVVDAILGALSLPDIGQLFPDNDPKWKGAPSSVFVKEAVRLMHEAGYELGNLDA
TLILQRPKLSPHKEAIITNLCALLGAHSSLINVKAKTHEKVDSLGENRSIAAHTVVLLMK
K
Download sequence
Identical sequences MA_60257g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]