SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_10265740g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10265740g0010
Domain Number 1 Region: 523-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-75
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 72-166
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000262
Family alpha-D-mannose-specific plant lectins 0.0095
Further Details:      
 
Domain Number 3 Region: 216-283
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000118
Family alpha-D-mannose-specific plant lectins 0.008
Further Details:      
 
Weak hits

Sequence:  MA_10265740g0010
Domain Number - Region: 374-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0745
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_10265740g0010
Sequence length 862
Comment high_confidence
Sequence
MDTAPQIFLTIFLMQLLILVGCGEGGPQHKSELVISSTRLKNSGWKPGNNTYLVSPNGTF
CAGFYNVSPNNYAFAVWYAHDPQLTMAWMANRDHLVGYNSSLTLKNGILTISDSDTQVVW
SATILASNAGMDMLLLESGNLVFNATNENHVWQTFDFPTFTLLPTQNFSKNSRLVSRRND
STYASGVYIFSASQSNTQTPSLYYNRSKLRSDQLDLYWAWTANNAVVSLGVDGYLCLRNN
GNLISSTNPNILMASDSGDPTSPLRRLTLDHDGNLRIYSWNGDSSSSWEVVWEAIQERCQ
IHGTCGDNAICKTPELNDSTPECQCPPGFNRSITDPRSCQRFIEFPQPLCSSNYQSVDYQ
FIPLDYVNFTEEGNQTNRNVAKLEDCMSACLNNCKCMGFSHKLDGSADCVHHFSRLLNGY
WSPESQARMYLKLSAKEKNVSNENPYRGMLSVAENVCEAAFSLPFPPNDSDHSTRYLIII
CSIFGIELFCGVLAFWAFLRQYSKYRDIAGIFSFDILFNLSGGGPKRFTYAELKAATNNF
RDEVGRGGFGTVYRGVLPDQRQIAVKKLERISQSEGQFWPEVTIIGRIHHLNLVRMWGFC
TEGEHRMLVYEYIPNGSLNKYLFDNQNERVVLEWSRRYRIAVGVARAIAYLHEECLEWVL
HRDIKPENILLDEAFCPKISDFGLAKLVERERSLSVSNIRGTPGYLAPEYWRQENQPITA
KVDVYSFGIVLLQIVSGRKNPFFSQSALEGDGWFFPNKVFEWVVLERNVEKVVDKNIVSG
VRDDRFQLEAIERMVKTAFWCIQSRPHDRPSMGKVVKMLQGTLDVPQPPRPDFFDRFLNT
ERSEYGDHIQELPAESVSTQEI
Download sequence
Identical sequences MA_10265740g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]