SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_10426598g0020 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10426598g0020
Domain Number 1 Region: 418-699
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-65
Family Protein kinases, catalytic subunit 0.0005
Further Details:      
 
Domain Number 2 Region: 104-203
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.03e-24
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  MA_10426598g0020
Domain Number - Region: 370-432
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00824
Family Pan module (APPLE domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_10426598g0020
Sequence length 715
Comment high_confidence
Sequence
MGSGNCIRDQHLLILGCFCLLALLLHIKPGDAAVCLLALLLHIKPGDAADAASDSILLGA
SLTGNETRISKEGKFKLGFFNLNNNNVNNWYVGIWYATAAQQTIAWVANREQPLQNSSGV
FNLTEDGSILLSYGGSIVWSSEGNMKKPSSAVIMDSGNLVVLSAKNTSEIIWQSFDHPGN
TWLPGMKVSMSQTLTSWRSPSDPSPGRFSLQMDPNGSDQYVLLWKNQTKYWETGVWNGQI
FSEIPEMRQNSIYDFSFVNNGSYKYYTYSVKHEFTYLSRFDVDESGELRVYLMLENKEWS
MFWALPRDQCEVYAVCGTYASCNGNNVQFCNCVPGFVPKDSREWESQQWSSGCVRKTPLQ
CNHAGNRTITDGFVELSGKSMPPQGVQYKGQGQCQEACLSNCSCTAYAYVLSGTSKTCKL
EGVNQGEKQFRMEVSTIGTIQHVNLVRLRGFCTEGSRRLLVYEYMPNGSLDSSLFHKAQS
DDQIQNKVLDWKTRFGIAVGTAKGILYLHEKCRDCIIHCDIKPENILLDSNFCPKVADFG
LAKLLGRDYSKVLTTMRGTRGYLAPEWLSGLPITAKADVYSFGMTLFEIIAGRRNMDEGS
ESNEVFFPMWAASQVNSGNAMDLLDKKLMGNADAEQVKRAAIVGGWCIQDDEDARPSMSE
VVQILEGIVDVPHLPPLPLSLQNFAVKPDSFVLFFWETSSSAHARNNSDHPSTKL
Download sequence
Identical sequences MA_10426598g0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]