SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_10427030g0020 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10427030g0020
Domain Number 1 Region: 38-192
Classification Level Classification E-value
Superfamily SIS domain 4.45e-40
Family double-SIS domain 0.0000349
Further Details:      
 
Domain Number 2 Region: 7-49
Classification Level Classification E-value
Superfamily SIS domain 0.0000133
Family double-SIS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_10427030g0020
Sequence length 192
Comment high_confidence
Sequence
MAFKDWRIIFIGCGTSYNVALAARSIVEELSGAPVTMELAMLLMGEQSLLMFGRGYNYAT
ALEVALKVREVVLMHNEGILAGEMKHGPLALVDETLPIIVIATHDNCFSKQQSVIQQLQA
RRGCLIVMCSKGEASLVCPNGCCRVIEVPQVQDCLQPIINIVPLQLLAYHLTVLHGYDVD
QPRNLAKSVTTE
Download sequence
Identical sequences MA_10427030g0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]