SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_10433041g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10433041g0010
Domain Number 1 Region: 457-574
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.77e-26
Family Protein kinases, catalytic subunit 0.0014
Further Details:      
 
Domain Number 2 Region: 58-179
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.93e-23
Family alpha-D-mannose-specific plant lectins 0.0014
Further Details:      
 
Domain Number 3 Region: 136-241
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000624
Family alpha-D-mannose-specific plant lectins 0.0026
Further Details:      
 
Weak hits

Sequence:  MA_10433041g0010
Domain Number - Region: 585-631
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00299
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_10433041g0010
Sequence length 670
Comment high_confidence
Sequence
MVGLDEAVDPGSSLTPSSSGQHRFWTSPTSNFNFGFHPVGNDGLYVLGISINDTSDETLV
WTAGENGGFRVGDKASFDFQIDGNLVLSNGTNTKVWQTNTTNQSVSSAVMQDDGNFVVKN
SSSKSVWESFANPTDTLLANQSFGVGQSLHMDPYSFTLESSGNFTLKWRNTITYWNQGTP
NSSTAHLSNQGIFTLSNSSGGQSWIAYSSDYTDASITLRRIRLDSDGNLRSYGWVKSSGI
WQLGWSAVEDQCQVYGWCGNFGVCVYNDTAPYCICPSADFSPIDPKDPTLGCRREQDLTG
CSNQSSNQTMVVLNNTEFFSYPPESESQSEIYNLGIRECQQNCLRSSLCFASTVMADGSG
TCRMKTENFTSAYQSAAIPSTSYVKVCGPGHLLAPPPPAILFVRSTKVSAILIAAAIVGP
IIALIIIQICFWFIFCRNNPRFRFGQLPSQYTLLDYASGAPVQFSYKELQHSTKNFMEKL
GSGGFGTVYKGELPNKTMVAVKQLEGIEQGERQFRMEVATISSTHHLNLVRLIGFCSEGR
HRLLVYEFMKNSSLDTFLFSSSEQSRTLDWDQRFDGKLGRDIDIDQVTRALQVSFWCIQE
QPSQRPTMGKVVQMLEGILFIDKPPAPKSLETFQSSTSGSASEMTISVLATPNHPVSSIS
SMNAIRSSNP
Download sequence
Identical sequences MA_10433041g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]