SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_10435726g0020 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10435726g0020
Domain Number 1 Region: 475-769
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-77
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 89-187
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.71e-23
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_10435726g0020
Sequence length 815
Comment high_confidence
Sequence
MGTENSMRELFPQILSCFYLLLVLLLQIKPGDAEEAVSDSIVLGTSLTGNQTRISKGGIF
KLGFFNLNKNDDKKWYVGIWYAKGSQQTIAWVANVEQPLENASSVLNLTEDGSLLLSYGR
STVWSSKGNGKKPSSAVIMDSGNLVVLNAENTSEIIWQSFDHPQNSWLPDMKISNSQRLS
SWRSPWDPSPGSFALRMDPNGADQFVLMWKNHTTYWESGVWNGKYFSNVAVNVYESALTY
FSNGSYKYASFSTKHGLSCLARLVMDNKSGQIRAYIMLENKEWSLVWQQPLTQCEVYAAC
GPYGLCNNNKVPPCNCVSGFVPRDSREWESEQWSSGCVRKTPLRCSHGGNRTTTDVFVEL
SGKSMPPGGVQYKGQRQCKAACLSNCSCTAYAYVNGTLRTCVMWFGELLNLADTSNGVSL
FLRLDAADVPHSSNSNKKASLAGVVGGVVGGVVAILAFVLLFIWCCKSPGLVATEYAPVG
LTVFTYKELQSATKNFSERLGGGGFGSVFKGTLADGCLVAVKKLEGVNQGEKQFCMEVST
IGVTQHVNLVRLRGFCIEGSRRLLVYEYMPNGCLSSFLFKKSPRDDQQHKLLDWKTRFGI
AVGTARGIVYLHEKCKDCIIHCDIKPENILLDSNFCPKVADFGLAKLLGREYSKVLTTIR
GTRGYLAPEWLSGLPITVKADVYSFGMTLLEIIAGRKNLDKVSESGELFFPAWAAAQISS
GNAMEVLDKKLLNDADAEQVERAAIVGGWCIQDDEDARPSMSKVLQILEGIVDVPPLPPI
PPSLRTCDDNLVVFSWDTDSSAFARNNNGGLSTPL
Download sequence
Identical sequences MA_10435726g0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]