SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_10436602g0020 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_10436602g0020
Domain Number 1 Region: 544-836
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.8e-78
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 98-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-19
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  MA_10436602g0020
Domain Number - Region: 413-451
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00051
Family Pan module (APPLE domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_10436602g0020
Sequence length 905
Comment high_confidence
Sequence
MESCNALCSLIFLCVIGASEGKFFALPSNWKVAINNSNLPRYSTEQGPFRAVTDGYGNAI
VSESHRFGLGFIDVNSSGKFVLSVVMGLNLTSLPAMEIWTANRNRTVAEGALIKLQSQGN
LVLEDSDGTVVWSIGTGKSSGILMAKNGNFQIYNTTNSSLVSAGSNLVWQSWDHPTHTLV
PGQALKRGQALVSNSSATKTSAGSYKLVMEPGGLVLFYTSSRQEPYWSMGLQGLDYQGIL
RPCFYNSSSVSSEAVYTVQNLTVSFNGTVGKSSSSSSSCANGNQSLSMAPPNFDNENEYK
FLRLDRDGSLRVYRVSPMPGQNDVKHWRSDYELDPSNKNCKLPTACGPYGICNNGQCSCP
GSGTDDEFNQIQSLDVTQGCYSRQGKPMCSQPSAPRHFMSLEGVDYYPNDYRKPEANVST
VEKCRSLCNSSCSCTAAFFRSSSSSCYFADGPLSSLKLTADQTYKAYIKVLNKLPPKGTS
GTSGFSNSLSIGSIAAITLSSAAAALFLCLITIIFVRRSRTTESVIDEEEIDLEEMEEEA
FLKTLPGLPPRFTYHELKEATDNFSRKLGTGGFGSVYEGILKDKTGVAVKKLDGPKQGYK
EFRAEVATIGSISHMNLVRLRGFCADSRQRLLVYELMENVSLDKWLFSRPDDNRGCLTWE
QRFNVAVGTARGLAYLHEQCREPIMHLDIKPQNILLDKSFMPKVSDFGMSKLLNDDMTQV
MTGVRGTPGYLAPEWLRYSIATKKCDVYSFGMVLLELVSGRKNFDPSAADPRLCYFPAWA
MLRALEGRYMDLVDKRLGDDSVDREGVTRMTKVAFWCIQDNPNQRPWMSVALKMLEGEWD
IPDAPMWLLQRGPQFLEGYGYEPMEDGDGDDGQREEASLVGNSVGAGGSFGSILTISSTQ
LSAAR
Download sequence
Identical sequences MA_10436602g0020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]