SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_1151g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_1151g0010
Domain Number 1 Region: 149-229
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000584
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 2 Region: 242-274
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000576
Family CCCH zinc finger 0.0013
Further Details:      
 
Domain Number 3 Region: 76-109
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000667
Family CCCH zinc finger 0.0021
Further Details:      
 
Domain Number 4 Region: 9-36
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000196
Family CCCH zinc finger 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_1151g0010
Sequence length 274
Comment high_confidence
Sequence
MESLPTGLRSKSKACTKFFSTSGCPFGENCHFMHYIPGGMNLISQVSNLGSGLGTASRKS
TGPPTSILPSDQAAPVQPYKTRICNRYGTAEGCRFGDKCHFAHSENELKKGNTLAPVERE
RTLSKDAVPGVMDGRPGGRLVQREPTPPGMAAAASFGASATAKISVDASLAGAIIGKGGV
NSKQICHTTGAKLAIRDHESDSNLKNIELEGSFDQIKLASTMVHELIMQTSAVAAKPSGF
VFNNYKTKVCENFSQGTCTFGDRCHFAHGASELR
Download sequence
Identical sequences MA_1151g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]