SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MA_116574g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_116574g0010
Domain Number 1 Region: 146-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-31
Family B3 DNA binding domain 0.0000289
Further Details:      
 
Domain Number 2 Region: 35-91
Classification Level Classification E-value
Superfamily DNA-binding domain 8.5e-18
Family GCC-box binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_116574g0010
Sequence length 340
Comment high_confidence
Sequence
MGSGTSTVSSENIHSYAPPSAQGEQEKSCKKLPSSQYKGVVPQPNGRWGAQIYEKHQRLW
LGTFNREEDAARAYDRAAIKFRGVDAVTNFNLVETHPEAIFLRGRSTDEIVDMLRRHTYE
EELQNNDTTCSSAAYPDIACSTPTEPREHMFDKAVTPSDVGKLNRLVIPKQYAEKYFPLD
EASGGDKGKGIMLNFEDNNYKTWRFHYSYWKSSQSYVLTKGWSHYVKEKRLQAGDIVTFE
RSSPSRRLFITFRRRPFSLISAATRPPTALLSYLCCYPTAATQTLPAFRQSLCSEWVSAP
GSPFLQAAAIGHRPRRPLFDSLRRQTQFSRLLADPQVCLR
Download sequence
Identical sequences MA_116574g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]