SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_121826g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_121826g0010
Domain Number 1 Region: 476-741
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.46e-59
Family Protein kinases, catalytic subunit 0.00033
Further Details:      
 
Domain Number 2 Region: 60-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.63e-26
Family alpha-D-mannose-specific plant lectins 0.0036
Further Details:      
 
Weak hits

Sequence:  MA_121826g0010
Domain Number - Region: 337-369
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0129
Family Pan module (APPLE domain) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_121826g0010
Sequence length 781
Comment high_confidence
Sequence
MFLFTCSHVSGIYISNHQCDIKKHGLSPGSSLTLQQNKTCLVSPKGTFSAGFYSVGDNAY
AFAIWYTRTRDRTVAWVANREQPVNGRDSRLHLRKDGNLLLLDADGSVVWSTKTSNMNVK
EAVLLESGNMVLRGSSGHVWESFQYPTDTLLPLQPLKNNLQLISRLRRGTFKQGYYRLSF
NSDSTLRMVYDGSGLTDSYGPFPAFRSTLYVQAMLNGSGCFQANDEPSIEASDYGEGPMR
RLTLDVDGNLRIYSLVEGTGAWSIVWTAVPDQCSVHGFCGIYGLCIYTPMPSCTCPPGFH
MKDSTDWFQGCQRNKQLTGNSASSTKLIYLPHTNYKAYDLSMPYKITLEECKRLCMNDSR
CEGFVYQMDGSGSCFPKYLLFNGYRSPGEKTLMYIKVSSNDSTVSNSTSVSQPLPLHCSA
SREEYKSYKIRNSNVKYPLTYFAIAFGVAELFCVILGWWYMSITYRDLGYERLGYSEIPG
GFKKFSFAELKKATDNFKIRLGEGGFGTVYKGVLPDREVVAVKRLEGVSQGHDQFWAEVS
MIGRVHHMNLVRMFGFCAEGNHRLLVYEYVENGSLDKYLTAESEEFGNGNDNHRVLGWKE
RFGIAVGTAKGLAYLHEECLEWILHCDIKPQNILLDMNFCPKVADFGLVKLVDRNHSFAF
STIRGTRGYLAPDSTGQNCGHLVQWVSAKMREGREVEEVVDPKLHGNFDSAEVKRVLKTA
LLCIEQEKDVRPSMSQAVEMLSQPDSFTSLDSMSSNDSAKSFRTLCSSSFAIESQQPAAE
S
Download sequence
Identical sequences MA_121826g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]