SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_1391g0030 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_1391g0030
Domain Number 1 Region: 56-116
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000209
Family alpha-D-mannose-specific plant lectins 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_1391g0030
Sequence length 144
Comment high_confidence
Sequence
MQTGNNEYVLSENKSAATEKRIDRTEKTENECFMQTGNNEYVLSIVLSRSFKQQYGEVVW
AANGDKPVSSNGILELKLDGNLVLSGSINGGSSASDRRTIWSTNTGAKGVTGMRLLGAVC
RIMVNYHRFKRFQWMIEFKIHTFS
Download sequence
Identical sequences MA_1391g0030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]