SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_175530g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_175530g0010
Domain Number 1 Region: 516-818
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.17e-75
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 72-160
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.98e-18
Family alpha-D-mannose-specific plant lectins 0.007
Further Details:      
 
Domain Number 3 Region: 233-297
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000654
Family alpha-D-mannose-specific plant lectins 0.006
Further Details:      
 
Weak hits

Sequence:  MA_175530g0010
Domain Number - Region: 363-416
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0133
Family Pan module (APPLE domain) 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_175530g0010
Sequence length 861
Comment high_confidence
Sequence
MYTVPQFFLTFLFTQLLILVGCGEGGQEHTSEFVISSTRLKNSGWRPGNNTYLVSPNGTF
CAGFYNVTPNNYAFAVWYANDPNRTVAWMANRDHLIGYNSSLTLKDGNLTISDSDAHEIW
SATILASNAGMDMILLESGNLVFSTSNENHVWQSFDSPTFTLLPTQRFSENSRLVSRRND
STYSSGAYIFSASQSNTQTPSLYYNRSELGSDQLDLYGVLHWLLATNYGIQFSLGVDGYL
SLGDDGNLINSSNSKILMASDSGDPAGPLRRLTLDHDGNLRIYSWKRDSSSSWVVVWEAI
QERCQIHGTCGDNAICKTPELNNSTPECQCPPGFHQNITDPPSCQRTIQFSNLSCSSNYQ
SIDNQFIPLDYVFFTGERNQTNLNVPRFEDCMSACLNNCECVGFYKWDGSRSCVHLFGRL
LNGYWSPESKTRTYLKLSAKEKNVSNPYTGMLSVVENVCEVTLALPFPPEPSNLIIIYSI
FGIELFCGVLVFWAFLRRFSRYRHIARIFSSDILLYLSGGGPKRFTYAELKAATNHFSDE
VGRGGFGTVYRGVLPDQRQIAVKKLKGVSQGEEQFWAEVTIIGRIHHLNLVRMWGFCTEG
EHRLLVYEYIPNGSLDKYFFDNQGGGERVVLDWSRRYRIAVGVARAIAYMHEECLEWVLH
RDIKPENLLLDDDYCPKISDFGLAKLVERERSLSVSNIRGTPGYLAPEYWIQENQPITAK
VDVYSFGIVLLQIVSGRKNLCFSQSTDEGDEWFFPKKAFEWAVLGRHMEEVVDKNIVSVA
RDDRFQLEAIERMVKTTFWCIQSRPDDRPSMGNVAKMLQGTLAVPQPPQPNFFLNFLNAN
SSEYGDHIQELPPISVSTQEI
Download sequence
Identical sequences MA_175530g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]