SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_180535g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_180535g0010
Domain Number 1 Region: 333-630
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-76
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 79-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.19e-23
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_180535g0010
Sequence length 678
Comment high_confidence
Sequence
MRDQLLHLLRFIIFLVLLQMKPLDAASDSIVLGASLTGRETRISKSSNFELGFFNLTDHN
VTNWYVGIWYATDSDSEQTIAWVANREQPLQDASGVFNLTEGGNLILSYGGSIVWSSMGN
KKKPSSAVIMDSGNLVVLSAVNSSESIWQSFDHPGNTWLPGMEISISQRLTSWRNDWDPS
PGPFSFQMDPNGLNQLVLLWKNDNTYWESGIWHDNVFSKLVGPDSSEVDDYGYRINSSSG
FSFFSNGSYKYFTYSTVNDPGRLVMDKSGQIRVYSMLEASGWKMVDSEPDSFQMPDDSHS
YKKPTLAGVVGGLVATVTLVLLFLWYRRRPGLSATEYAPGMLTVFTYRELQSATKNFSER
LGGGGFGSVFKGTLPDGSLVAVKMLEGVSQGEKQFRTEVSTIGTIQHVNLVRLRGFCTEG
SGRLLVYEYMINGSLNSFLFHRSQSDDQQLEVLDWKTRFGIAVGTARGIIYLHEKCRDCI
IHCDIKPENILLDSNFCPKLADFGLAKLLGREYSHVLTTMRGTRGYLAPEWLSGLPITAK
ADVYSFGMTLLEVIAGRRNMDWDSESSELFFPTWATTQITSGNAMDLLDEKLMNNADAEQ
VKRAAIVAGWCIQDNEDDRPLMSEVLQILEGIVDVPPPPPIPPSLQTFALKPDSLVVFFW
EDSSTRNNDNSDNPSTTL
Download sequence
Identical sequences MA_180535g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]