SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_19963g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_19963g0010
Domain Number 1 Region: 408-684
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-71
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 73-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 6.28e-25
Family alpha-D-mannose-specific plant lectins 0.0045
Further Details:      
 
Weak hits

Sequence:  MA_19963g0010
Domain Number - Region: 265-324
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0204
Family Hairpin loop containing domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_19963g0010
Sequence length 722
Comment high_confidence
Sequence
MKIKCQFYLHWCFVVFFAGVIGAADDTITPGSGLTGSRTIISKNGKFELGFFEPSGADKW
YIGIWYAEIPLRTYVWVANRETPVGASAALKFTEDGRLAVVDANNASVWETGNRRSAASR
AVILDSGNLVLMESGNGGVVWESFDNPADTWLPGMKIRYRQCLTSWKTATDPAPGDFSLQ
LRLTSGAVKFSEFLLVWRNSVQYWTSGKWDGDSFSDIPEMTVKYIYNFTFVHPNSSDGNP
QAWDSQDWSGGCIRSSPLQCKTDKFYELSNADFNRSSSAFVPGVLLKSCENFCLGNCSCT
GYTYRGDLKECRLLWGDLWSLRNYSNEDEDDVVGSSNFGTRNSTLLYIRVAACDLPENGL
SRRKVNPRVLIGVFSGIVFFALIVTLNLYCWRRWKLAKSSTADEGFGASMLTIFAYKELQ
IATRNFSEKLGSGGFGSVYKGTLAGSIPIAVKKLERPEGGEKQFRMENSIRLRGFCSEGD
RRLLVYDYMPNGSLNAFLFKEQQNFLDWKSRFRIALGTARAIAYLHEECRDCIIHCDVKP
ENILLDEDFNAKVSDFGLAKLIGRDFSRVLTTMRGTRGYLAPEWISGLPITAKADVYSFG
MTLLEIMGGRRNVETSNVESEKWFFPPWAAKQVSLGNIMELLDGRLGKDIDEEEVRRTAM
VAIWCIQDDEESRPTMGTIVKMLEGVVDVLTPPIPRTLQSLMDENTEAQANPSWMKILRL
RL
Download sequence
Identical sequences MA_19963g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]