SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_202506g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_202506g0010
Domain Number 1 Region: 434-728
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-79
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 43-168
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-23
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Domain Number 3 Region: 824-879
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000234
Family ABC transporter ATPase domain-like 0.0035
Further Details:      
 
Weak hits

Sequence:  MA_202506g0010
Domain Number - Region: 314-351
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000275
Family Pan module (APPLE domain) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_202506g0010
Sequence length 880
Comment high_confidence
Sequence
MNWIDYGGICLYSANKTFSLVFFNHASDRGFFLSIKHTRSALIVWTANRNTPIANTDMFE
FSNDGDASLTLGGEVIWSTQTRGKNVETMELQESGNLVFLNKDGQVLWQSFDSPTDTLLS
HQSLRVGMKLISNSGVSNFSSGKYTLKMQAGNLVLYADYNPPQIYWAMQQDTRRTFLFEG
SPVTAILSQRYWGMYDKDQTLLTQFVLSNFPMVPGICVAVLGTQGRITFKFLAETITNDD
LMSIPAEFCQLPNSCGSYVVCSGNQQCECPQVLSSMYVSKCSPPPLPPCRSSNHSAKLYK
IGDGFNYFANQFVKPLKTSGLVDCQQACEKNCSCSALFFDNKTGGCYLFNEIGSLQVSED
DSTTLTAYFKAPSISTNDSSLIQGKENKRHFPYFVIIVVSTAIVLVAIMSFGYWFCWKKL
ARGTLNDSSEDERFLNNIPGLPTRFSYRQLQIATDNFSRRLGRGGFGSVYEGTLPDGSQV
AVKQLESIGQGKKEFHAEVATIGSIHHVHLVRLRGFCAEHIHRLLVYEYMANRSLDKSLF
SDKRRGVILDWDKRYNIALGTAKGLAYLHEDCSVRIIHCDIKPENILLDENYKAKVSDFG
LAKLMTREQSHVFTTLRGTRGYLAPEWLTTYAISEKSDVYSFGMVLLEIIGGRKNFDSEE
TSEKCFFPAYAFKQMEEGKLENILDAELEYDASDERLSRAVRVALWCTQEDFASRPSMGK
VVQMLEGVMHIPEPPVSHQTGFRMHQSILSLNPISEEGSSSNPSDYNNQDMLSAVRLSGP
SGLSLGQAAPDISAFGRAQGAACSIFEMINRGSSGKSSSGKGSRLQNVRGNLELRNVRFS
YPSRPDVIIFEDLSFSIPAGKVVAIVGGSGSGKSTVISFI
Download sequence
Identical sequences MA_202506g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]