SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_202714g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_202714g0010
Domain Number 1 Region: 58-181
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-23
Family alpha-D-mannose-specific plant lectins 0.0018
Further Details:      
 
Domain Number 2 Region: 354-474
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.3e-22
Family alpha-D-mannose-specific plant lectins 0.0018
Further Details:      
 
Domain Number 3 Region: 750-821
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000381
Family Protein kinases, catalytic subunit 0.0033
Further Details:      
 
Domain Number 4 Region: 432-537
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000192
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 
Domain Number 5 Region: 136-231
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000784
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_202714g0010
Sequence length 911
Comment high_confidence
Sequence
MVGVDGAVEPGSSLTPSSSGQQQFWKSPNSNFNFGFHPVGNDGLHVLGISIINASDGTPV
WTAGENGGIRVGDKASFGFQIDGNLVLRNGTNTTLWQTNTANQSVSSAVMQDDGNFVVKN
SSSNSVWESFDNPTDTLLVNQSFRLGQSLHMYPYSFTLESSGNFTLKWRNNITYWNQGAS
NGSRARLNSQGIFTLFDSSEVQLRIAYSSDYTDASITLRRIRLESDGNLRFRSRRSQGCH
TRVQERAGPSSQSMVLLNNTEFFSYPPESESQSEIYNLGITDCKQNCLRNPLCFASTIMA
DDGAVEPGSSLTPSFSGQQQFWKSPNSNFNFGFHPIGNDGLHVLGISIDDTNGTLVWTAG
ENGGIRVGDKASFDFQIDGNLVLRNGTNTTLWQTNTANQSVSSAVMQDDGNFVVKNSSSN
SVWESFANPTDTLLVNQSFRVGQSLHMYAYSFALEPTGNFTLKWKNNITYWNQGAPTGSR
ARLSSQGIFTLSNASGDQLWMAYSSDYTDASIALRRIRLESDGNLRSYGWVKSSGTWQLV
WSAVENQCQVYGWCGNFGLCVYNDTALYCICPSADFVPVDPKDPTQGCRREKELAECGNQ
SMVVLNNTEFLSYPAESESRSEIYSMGITDCQQNCLRNPLCFASTMMADGSGTCRMKTEN
FTSAYQSAAIPSTSYVKVCGQGRPLAPLPSAIMFVRSTKVSAIRIAAAVVGPIIALITIE
ICLWFIFCRNNPRFRFGQLQSQYTLLDYASGAPVQFSYKKLQHSTRNFMEKLGSGGFGTV
YKGELPNKTIVAVKQLEGIEQGERQFRTEVATISSTHHLNLEQPSQRPTMGKVVRMLEGI
LPIDKPPAPKSLETFQRSTSGSASEMAISVLATPSHGVSSISSVNATCLQISKEIQNRDS
PAADSYLLKAT
Download sequence
Identical sequences MA_202714g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]