SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_208216g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_208216g0010
Domain Number 1 Region: 527-786
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-46
Family Protein kinases, catalytic subunit 0.00065
Further Details:      
 
Domain Number 2 Region: 92-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-25
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 
Domain Number 3 Region: 184-293
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000324
Family alpha-D-mannose-specific plant lectins 0.0021
Further Details:      
 
Weak hits

Sequence:  MA_208216g0010
Domain Number - Region: 344-456
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0275
Family Papain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_208216g0010
Sequence length 847
Comment high_confidence
Sequence
MGLQLSSALFNAGYKNAILLGMLLVALFLMPTVASSSQNHIPLGSKVFASESKSSYWVSE
NGTFAMGFYSRQQDGSFSVGIWYHSLPMHAQAVVWTAGGDVTVSPNSTFELSVDGNLILF
DDSTGAPAWTSNTSNRGVVGASLFDNGNLVLSDTGQNTVWDSFQTPTDTLLPGQRFEMNQ
SIRASSKNAIASYYNLDMEETGNLVLRWCSEVIYWESGTKGQFSSSKSDNPIGAILQGNG
VLGLFDRQGTIIWSRYSEDFTDPNVNLRLLRLDADGNLRLYSWIEKLQVWKVGWQALENQ
CDVFGTCGLYGVCSFNATGPFCKCPFERGGSEATVSLEMGSERACRKLMKLGSCNEGNTL
MVMNHTFLYGMFPTHDVYNYFNTEACMKNCLEDRYCVAATALNDGSGICRIKRTSFISGY
HYISVPAISFVKVCLTPEAVNNQIIFGYPQTSNSDSSPFSSLPSVSSTHGLSGIFIVRAI
LPTVLIFLAIQVGLSWYAFKRRRTMQKMLSAKHELTDQHCRVPISLTYPEIQELTENFRH
KLSRTGFKGTLSSMKPVIVKQLDVETTEREFRKALSIIGSTRHKNLVSLHGFCCEDQQRL
LVYEYVNNGSLHQWLFGSMKQGKDLNWQRRLEIAKGIAHAIAYLHMECHECIAHSNLKLE
NVMLDDKFMPKLTDYGLNRLSQGTSNQSTTSSESHPEQDVFSFGTMLLEIITGKRYPSDG
CLGKGRFCKWVFQEYQIGNLDRVVDCRMGCNWNWFQVERALRIAFWCIQEQLFLRPSIRE
VVKVLEGTFPVDKPPIPQTIAQEVHGGACSKLKEVVTEEEELKDQVNATGKECCLQLTTI
SYGAQTE
Download sequence
Identical sequences MA_208216g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]