SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_25658g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_25658g0010
Domain Number 1 Region: 51-131
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000327
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_25658g0010
Sequence length 189
Comment high_confidence
Sequence
MHWIESRIDSKVIPVGLKRFKGMFNYTFLCMVLYVCVYEAPAKSVCESPYEPIMTTNPFI
VLLSDNGLEIMDGNNEDVWNNNTSNNYQSLVLRENGALQLVDKKRQTVWSSTDHPRVNQN
WGTVLQPGSSPFINPPFASPLQAQLPNGQPVFLHPFTTANPIMGSAPPQIIHPYYQVVVG
CLIAIFFHP
Download sequence
Identical sequences MA_25658g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]