SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_464529g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_464529g0010
Domain Number 1 Region: 459-753
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-62
Family Protein kinases, catalytic subunit 0.00057
Further Details:      
 
Domain Number 2 Region: 54-185
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-16
Family alpha-D-mannose-specific plant lectins 0.0054
Further Details:      
 
Weak hits

Sequence:  MA_464529g0010
Domain Number - Region: 344-380
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00149
Family Pan module (APPLE domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_464529g0010
Sequence length 793
Comment high_confidence
Sequence
MKTRRSEALRWNGFILLLFLVCGGVCYGQDSIEPGFTASPMKYLDKEVHNETGAVVWSAN
RDLPMADSGEFRLTKTGAEIQNSVGEILWSAAMKNGSIDVIKMKLRDDGNLVMLGAGSKS
LWESFDYPTNTLLTGQRLVQGSSLVSNAADTNFSLGDYKVSLTDRDLVLVWNSGEPQTYW
SMARANGTVHLGADLTDVGYAALTDSGFSLYSKSNGSSLVWQLTNPGGALTRAVIWPGGQ
FEISSLIKGNWVTDLNAVKDACLLPKTCGSLGVCTGLTPTGPPQCSCPARLQFINQTDAS
EGCSTRWKTPGCDANYTDLLTKKFVQFVSLGQGVDYFADQFQNPIRSSISFSDCQQLCLK
NCSCAGFSFKKDSGSCFVHETLGTLISNYTLDSAFLKVIRTENPVLLIVLGSVGAVLVAA
MLISIGWLLCRKHGQQILPRFPDSSDVDDEHVLQSIGGLPTRFSYKDLQTATNNFAHAIG
SGAYAVVYEGTLPDATKVAVKKLHSSDSTTDGKRREEFIMEITTIGSIQHVNLVKLRGFC
VEGPNRLLALAYLHDECSEKIIHCDIKPENILLDDESQTKVSDFGLAKLMSRDQSQAMMS
NMRGTRGYMAPEWLTHAPISHKIDVYSYGMVLLEIVSGRKNFSQPNSFSNTDSIFDLSFN
LNYFPAYALQLCQMGGPFTVLADPRLEGRFPAEEVNRLVKIALCCLHEDSKMRPSMSKVV
QMLEGNLRVDDPQVESLLFLRVYARRINSHIPTSEASSFVGSGEYSTYTTRSSSFNSPTQ
MSMISAAQLSEAR
Download sequence
Identical sequences MA_464529g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]