SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_5708g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_5708g0010
Domain Number 1 Region: 498-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-73
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 85-214
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-19
Family alpha-D-mannose-specific plant lectins 0.0044
Further Details:      
 
Weak hits

Sequence:  MA_5708g0010
Domain Number - Region: 386-420
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0392
Family Pan module (APPLE domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_5708g0010
Sequence length 844
Comment high_confidence
Sequence
MNPIFERSINMDFPMWLPLLAITGCIIFQALASAAQYPSALYLGDSCVENAGKNILQSKN
GMFALKFSTFDNQTQYLVIAHIRWNETIIWAANRNKPIRGKPCLKPGPGGDLILQDTDGS
LAWSAHASQVNHLELMDSGNLMLQDTKNVTIWASFDYPTDTIVEGGHMGSGKALVSIKSL
TELSEGPYMMKMEPGGLVFYASFPSPLPYGVWTYNPLDSQSSSSLNFALHSACNNTILRY
ESNGASINLEQVLNVSAKCMQETHDQPLNRTQVLIAAHLGNDFFRFLRLDSDGNFRAYTQ
SATQLFSDSDMFSNYFRDICKLPDICGSLGICSSGVTCSCQDDAIFNEFQHNLGCSPRKN
PICGASNQLLELEGVDYFANEYTNPGSASLEQCRNSCLLNCSCAAAFFWSNSGGCYHYQE
IKSLKRVSDQSIKAFIKVGPGSFKETHHPTERKTNVLAIAVSGVCILVIVSALGFLAWRY
KVKKKVVKPKSEEDEFLENLPGLPPRFTYKEMEETTEGFSRQLGVGGFSVVFEGKLADGT
KIAVKKLGNADTGHFQFRAEVATLGSINHVNLVRLLGFCADGTYRLLVFEYMSNGSLDRW
LFRRPYDKNPLPFLDWRKRYKIIHDMARGLAFLHDKSRDRILHLDVKPQNILLDENFGAK
LADFGLAKLIDRDQSRAFTRVRGTPGYFAPEWLLHAYATDKSDVYSFGMVLLEIISGRKN
LDLSKQEEMEFFPSWAISMIEKGEIRNVVDPKLGDLAEHEWKQAKKVIKIAFHCIQEAAQ
ARPSMNEVILMLEGNTKVENLPLCIEFLMRTGARISAHPSQWEIPCTKSTSSNAATISGP
LSPR
Download sequence
Identical sequences MA_5708g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]