SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_619289g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_619289g0010
Domain Number 1 Region: 539-836
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.55e-77
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 98-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.11e-17
Family alpha-D-mannose-specific plant lectins 0.0069
Further Details:      
 
Weak hits

Sequence:  MA_619289g0010
Domain Number - Region: 411-448
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000141
Family Pan module (APPLE domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MA_619289g0010
Sequence length 856
Comment high_confidence
Sequence
MESPDAMCTLIFLCLIWASEGKFFALPSNWKVAINNTSLPRHSTVQGPFRAVTDGNANAI
VSENNRAGLGFIDVNSSGKFVLSVVLGLNLTTLPAMEIWTANRNRMVAEDATLRLRGNGD
LVLEDSDGTVAWNISTGKPKGILMAKNGNLQIYNTTNSSLASAGSNLVWQSWDHPTHTLV
PGQVLKRGQALVSNSSATNTSAGSYKLVMEWGGLVLFYTSSTQEPYWSLGLPGLDYESIL
RPCLYNSSPLGSEAVYTGQNLQVSFNGTIDNLSSSACANGNRLLPMAPFYNDNEHRFLRL
DSDGSLRVYRVAPVPGLNNVTNWSTDWELDQSNKNCILPRACGPYGICANGQCSCPGYGT
RDQFEQIQNLDVTQGCYSSPGEPSCSQPSATNHFMLLDGVDYYPNDYLKPEENVSTVEKC
TSLCTSNCSCTAAFFRSSSTSCYLEDGPLSSLKSAPNQNQTYKAYIKVLNKFPRNGTSGS
SNSLSIGSIAGITLSSAAAALFLCLITIIVVRRSRTKESVIDEAEIDPEEMEEEAFLKTL
PGLPPRFTYHELKEATDNFSRKLGTGGFGSVYEGVLKDKTGVAVKKLDGPKQGYKEFRAE
VATIGSISHVNLVRLRGFCAYARQRLLVYELMDNCSLDKWLFSPPDHGGGGRSKGCLTWE
QRYNVAVGTARGLAYLHEQCREPIMHLDIKPQNILLDKKFNPKVSDFGMSKFLNDDMTQV
VTAVRGTPGYLAPEWLRHSIATKKCDVYSFGMVLLELVSGRKNFEPSAADPRLCYFPAWA
MLRALEGKYMDLVDKRLGDNSVDTESVTRMTKVAFWCIQDNPNQRPWMSVALKMLEGDWD
VPDAPMWLLQRGPEDR
Download sequence
Identical sequences MA_619289g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]