SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_7917g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_7917g0010
Domain Number 1 Region: 561-815
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.55e-64
Family Protein kinases, catalytic subunit 0.0002
Further Details:      
 
Domain Number 2 Region: 140-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000107
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Weak hits

Sequence:  MA_7917g0010
Domain Number - Region: 23-56
Classification Level Classification E-value
Superfamily ssDNA-binding transcriptional regulator domain 0.0628
Family PMN2A0962/syc2379c-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_7917g0010
Sequence length 910
Comment high_confidence
Sequence
MVLSRRGRNWFNERSRTTVLSNKVVVGVDRWRRELQEEEQEALVNLVNSLHISLNNASSQ
GKTMMELLIEQRQGYQQLRDEVEAIYSEVVELRSRPVSPPSSISSSTIFDVTSSLDPPRH
VPNLNSPQTLKKGEKEGLYVVGIAFANINDTTLVWTAGGGAQVDEGAQFRFQSDGDFVLL
NGMGFLVWKSDTANKGVVSAVMRDDGNLVLKNRAPETCGKASTTPLILSSLVRCLLWEKF
SLCILTLSLSIHPEIPLSNGRATSRTGTSGPPRSPPTCSEYRSVLRGYSRSPIPPVGWSA
VQDQCRVYGWCGNFGVCVYNSTMPYCICPSLDFTAVDPKDSMKGCRMKEDLISCPSNQSM
VRVTHTQVFSYPPESSDDIFFLGRTDCREICLRNPTCAASTVLTDGSGTCRLKISNFTSA
YHSPAIRGSSFIKVCGPGRPLSLISPPLPLASPSTKNETSAKLFSEIGRLKISNFTSAYH
SPAIRGSSFIKVCGPGRPLSLISPPLPLASPSTKNETSAKLFIVGIILVVTGTVIVMIVF
ETGLLWACWRNNPRFRSPSTEYTLLEYASGAPIQFSYKELRQATHDFKDRVGSGGFGTVY
KGTLPNRTIVAVKELEGIEQGEKEFRMEVATIGSTHHINLAKLIGFCSERRHRFLVYEFM
KNTSLDNFLFPSTDEFSRKLDWDTRFSIALGTARGITYLHEECRDCIIHCDIKPENILLD
DNFQAKVSDFGLSNLINVREHRYRALTSVIGARGYLAPEWPANLPINSKSDVFSYGMLGE
RLNMDQVQRAMQVSFWCIQEQSSRRPSMGKVVQMLQGVLPIERPPAPKSFEGLQSSVRSN
TSHSIISVLVTSTLPVTSSTSGHVFERSDSRISVLAVANSSIPVASFSSGRVFELSDSQK
NMQEIISSER
Download sequence
Identical sequences MA_7917g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]