SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_895977g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_895977g0010
Domain Number 1 Region: 338-596
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-72
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 1-67
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000759
Family alpha-D-mannose-specific plant lectins 0.011
Further Details:      
 
Domain Number 3 Region: 23-127
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000432
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MA_895977g0010
Sequence length 834
Comment high_confidence
Sequence
NFVVKNSSSNSVWESFDNPTDTLLVNQSFRLGQSLHMYPYSFTLESSGNFTLKWRNNITY
WNQGASNGSRARLNSQGIFTLFDSSEVQLRIAYSSDYTDASITLRRIRLESDGNLRSYGW
VKSSGTWQLGWSAVEDQCQVYGWCGNFGVCVYNHTAPYCICPSADFVPVDPKDATQGCRR
EQDLVGCSNQSMVLLNNTEFFSYPPESESQSEIYNLGITDCKQNCLRNPLCFASTIMADG
SGTCRMKTENFTSAYKSAAIPSASYVKVCGQGRPLAPPPSAIMFVRSTKASAIRIVAAVV
GPIIALITIQICLWFIFCRNNPRFRFGQLPSQYRLLEYASGAPVQFSYKELQHSTKNFME
KLGSGGFGTVYKGELPNKIIVAVKQLEGIEQGERQFRMEVANISSTHHLNLVRLIGFCSE
GRHRLLVYEFMKNSSLDTFLFSSSEQSRMLDWDKRFGIALGTARGIAYLHEECRDCIVHC
DVKPENILLDDNFSAKVSDFGLSKLINQKGHRKRSLTSVRGTRGYLAPEWLANLPITTKS
DIFSYGMVLLEIISDEKLGTDVNIDQVKRALQVSFWCIQEQPSQRPTMGKVVQMLQGILP
IDKPPAPKSLETFQRSTSGSARERAISVLATSSHPVSSISSVNRLSSRRAGNRRLNLEHH
DLDRGWLVVNPFGVTEPTVGWKRAPLSAVAPHLVGGWTWQRHESPGVFGPAHRHFGVSAL
EKPKGETLHRHRSRNPDFGFRGLKSRKTRLACILNSRLPKSRYGQDGRIRGKICIRRSQR
RDDFKFQGWRVERLDSLAFQTPGYRNHDTAKTVGSGGRFAAVDPNKGTISGFGV
Download sequence
Identical sequences MA_895977g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]