SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MA_91618g0010 from Picea abies

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MA_91618g0010
Domain Number 1 Region: 522-793
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.35e-44
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 
Domain Number 2 Region: 91-217
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.58e-23
Family alpha-D-mannose-specific plant lectins 0.0017
Further Details:      
 
Domain Number 3 Region: 176-286
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000301
Family alpha-D-mannose-specific plant lectins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MA_91618g0010
Sequence length 874
Comment high_confidence
Sequence
MVTAAIHSLIRDPWSLVILWTGILTSLLSFVSSDDHIWAAIALGSKLSPAENHTWVSPEG
TFAMGFYPAFGQADEYSVGIWFNSIPAEAQTVIWTAGEDLKVRLNASLELTIDGNLVLFD
YLRGVPAWTSNTSHSGVVGAVLRDNGNLVLSDSSHRTMWESFETPSDTLVPGQRLHVGQT
LRAASRKSTSSYYNLVMERTGDLVLKWESDVSYWVSGIGSLPSDSIPIGAMFAGDGAFVL
FDGRGRTAWYRYSNDYTDTKVVLRYLRLDVDGNLRMYSWIQESQSWKSGWQAVENQCDVF
ATCGVCGVCSFNSTGPVCECPFEGRSDATVDLNGAGQGCSRLVPLGNCKEGGGVSMHAMK
RTVLYGLYPPHDVYVNTSSEKCKEQCLNDDLCVAATAMNDGSGVCKLKRTVFISGYTYGS
VAAVSFLKKPEAVSSQIVSRGIGQPTSSPVSSNASNLSPGSAPRICRVCLVGASLGTLGA
FIVIEAGVGLYIFKKRRRRNKAFHSGKLALLNTTNTGTLIRLSFSEVEELTRNFKEKLGP
SVFKGVLSNDKAVAIKQFNMAVGEKQLRMTLSTLGSIHHRNLVQLQGFCCESKHRFLIYE
HISNGSLAQWLFGGGSTKKQAKRLTWQRRLGIATGIARAISYLHSECRECIPHGNLKLEN
VLLDDEFTAKVTDFGLEEIKAGSRSFSSSESSPERDVFRFGEMLLEIISGKRERDSCGSE
ENSNSNNSSSVCRWSWEWAYREYQMGHLESVADCRMEGNVEWNEVERALRIALWCMQEQS
FSRPSMNEVVKVLDGTLQVDPPPPIASSPLGIGTLPDNGGASCSNLLCETPKESDGDKYA
ELAMCTIIHSGRESSPQQGKHNLWNSIAALTGWI
Download sequence
Identical sequences MA_91618g0010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]