SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000005911-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000005911-RA
Domain Number 1 Region: 46-129
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.13e-22
Family Inorganic pyrophosphatase 0.0006
Further Details:      
 
Weak hits

Sequence:  PITA_000005911-RA
Domain Number - Region: 161-196
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0212
Family Inorganic pyrophosphatase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITA_000005911-RA
Sequence length 202
Comment protein AED:0.22 eAED:0.22 QI:249|0.37|0.22|0.88|1|1|9|466|202
Sequence
MTPPSADGPAKIPVPPSAEGPRNGGESRFPHPPLNERILSSLSRRSVAAHPWHDLEIGPG
APSVFNCEPVYPGCFLRARAIGVMPMIDQGEKDDKIIAVCADDPEYRHYKDIKELPPHRL
AEIRRFFEDCILLHFSFNLPDSLFLLDLTQSSLSRSMCFHPDKKNENKEVAVNDFLPAST
ACEVIQHSMDLYATYIVESLRR
Download sequence
Identical sequences PITA_000005911-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]