SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000051951-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PITA_000051951-RA
Domain Number - Region: 82-108
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.00111
Family Inorganic pyrophosphatase 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITA_000051951-RA
Sequence length 124
Comment protein AED:0.36 eAED:0.57 QI:0|0|0|1|0|0|4|0|124
Sequence
MVARMHKNDKSEMIQEKEDVENPRKGSTKGENVPSDICAPQSSIGVEQKNLNIPMLAVDE
NEILKYLELLQFLVVLWMSEKEPILPRYFLRFRAIGLMPMIDQGERDENNRIEHVEFHHD
CDIK
Download sequence
Identical sequences PITA_000051951-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]