SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000071377-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000071377-RA
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.24e-23
Family Inorganic pyrophosphatase 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITA_000071377-RA
Sequence length 118
Comment protein AED:0.37 eAED:0.38 QI:0|0|0|1|0|0.5|2|0|118
Sequence
MNWNYGLLPLTWEDSSLANAKVKGEFDDNDSVNVVKIGERQAKIGRVPKVKPFAALEMVD
EGVLDWKIVAISVDDPRVPLVNDVNNEIGAKIEVATEDTFYYKKGKLPIKQNTKKGKL
Download sequence
Identical sequences PITA_000071377-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]