SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000077699-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000077699-RA
Domain Number 1 Region: 121-198
Classification Level Classification E-value
Superfamily IpsF-like 2.75e-17
Family IpsF-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000077699-RA
Sequence length 199
Comment protein AED:0.34 eAED:0.34 QI:0|0|0|0.33|1|1|3|0|199
Sequence
MAGNKESQKPVIVFNRTQVFVGERENFKQLVQQLTGKKEKSRATSELEKPGTQPVRPLSL
SGPNATQDYLFEDLVNNVFYGSADGPSNGMTLETPGTQPVRPPSLSRPNATQEYLFEDLV
NNVRLMHGVGYELGNLDPTLILQRPKLSPHKEAIITNLCALLEAHSSILNVKAKTHEKVD
SLGENRSIAAHTVVLLMKK
Download sequence
Identical sequences PITA_000077699-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]