SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for PITA_000040012-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000040012-RA
Domain Number 1 Region: 166-275
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.44e-29
Family B3 DNA binding domain 0.000017
Further Details:      
 
Domain Number 2 Region: 37-93
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000157
Family GCC-box binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITA_000040012-RA
Sequence length 445
Comment protein AED:0.03 eAED:0.06 QI:0|0|0|1|1|1|2|0|445
Sequence
MERGLSDVARSGGEPDTCEDLRRYSMSMDQAVILPPSQYKGVVARPNGPWGAKIYEKNQR
LWLGAFNSEVDASRAYDGAVLKFRTQDAMTDFSPVRDGDQETRFSRMHSTGKIIDMVTAA
HSATMNNAEDPSWTEGSDLRDDVCQGMQRVVDGNANASAVVACLPGEHLFDKAVTPSDVG
KLNRLVIPKQHAEKYFPLDINACEKGLLLDFQDNTGKVWRFRYSYWNSSQSYVLTKGWSR
FVKDKKLEAGDIVSFQRGLAESHQLYISCRRRPSCQAPQRIDRRCQQSKGGMVYPVFGSA
SLNPFNSGAQATVLYNSQWMPLFWPSSSNPVSLTQFMNSHSVSPLVKKVDAMWSPSTVTP
LKGTPPFYLSTSPTKTTAQSKSHDIISSGFHRFHNSQDSGDPLVNPAPPSVAQEWESPED
NARLNLDPTTKKGNRRGCQHSIRDS
Download sequence
Identical sequences PITA_000040012-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]