SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000041227-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000041227-RA
Domain Number 1 Region: 142-251
Classification Level Classification E-value
Superfamily Bet v1-like 8.38e-31
Family STAR domain 0.0082
Further Details:      
 
Domain Number 2 Region: 3-93
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000011
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000041227-RA
Sequence length 666
Comment protein AED:0.09 eAED:0.07 QI:0|0.81|0.88|1|0.68|0.76|17|396|666
Sequence
MGDCNMEGWLYTIHPKRLRLHSSRKKYFMLHGNTLICFKSPPTESKEVLFVFTLYDSSNH
DDNLKLGARSSEEAARWMHFLKEAALQAQPCQEDRLLIYSKNRRLSSRSSTRKESALLRT
TAGLRLFEEARDGEFKSKCWGDHRAVMAVGVVDATCESIFETVMALGPSRLEWDFCYLRG
KVIEHLDGHTDIVHKQFHSNWLPWGLTPRDLLLLRYWRREDDGSYVILYHSVEHRKCPPC
HGFVRACIKSNARLQRNRTRVKISQSENMHLWFMPFVGGGYVISPLTRPQQHASAVVKHM
LAVDWKYWKSYLRSSCERNITLKMLGRIAAMREMFKAKLVHYPCSELSSCELINENATNQ
MDGRHVKEDTSPMTQEEQSSDVTLQVHDTFLQANDSAGSFLQFSDAMDEFIDAPEDSNHG
SSALDSDQCSEQFIETEGYPDYAQVSKCQSGGPNMLSTAAVFVKRLHELASAAQKRSQVD
TVGAQDDADFLSYEATLPKNSACTLPSSWAVADPATFLIRGKSYLQDRQKIKAKDTLMRM
VAADWLRSDKREDNLAGRPECFIQGSWIVKQSVGKTACLVGQALEINYPRGSNYLELDVN
IGSSSVAKGVVNLVLGYLSKLVIEMAFVIQANTEDELPEFLLGTCRLNHLDASKSIPADQ
KYSQAA
Download sequence
Identical sequences PITA_000041227-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]