SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000050621-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000050621-RA
Domain Number 1 Region: 94-192
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000523
Family alpha-D-mannose-specific plant lectins 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITA_000050621-RA
Sequence length 249
Comment protein AED:0.28 eAED:0.28 QI:0|0|0|1|1|1|2|0|249
Sequence
MCEAQAVAAAGSIQRTQIHQVLAALRTPSVNSGVGISTTAGPLSTPLTGTQVFMTSQSAT
FSAMLIRQQTYTAVGGLGTDFCYIDVINTAAQQSVWQSACEPITTTNPCILQLSDNGLEI
MDGNNRDVWNNGASNNYQSLVLLENGALQLVDKKGQTIWSSTDHPRTIWSSTDHPRVNQN
CGTVLQPGSSPFINPPFASPLQAQLPNGQPVFTQPFTTANPIVGSGAPQKIHPYYLIAAG
CLIALFPFP
Download sequence
Identical sequences PITA_000050621-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]