SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000053208-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000053208-RA
Domain Number 1 Region: 70-151
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000017
Family alpha-D-mannose-specific plant lectins 0.0064
Further Details:      
 
Weak hits

Sequence:  PITA_000053208-RA
Domain Number - Region: 208-251
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0172
Family Protein kinases, catalytic subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PITA_000053208-RA
Sequence length 277
Comment protein AED:0.23 eAED:0.24 QI:0|0|0|1|0|0.5|2|0|277
Sequence
MSATPQLFLKCFLMQLFILLGCGEGGERKELVVPSTRLKNPGWKPGNNTYLVSPNGIFCA
GFYNVSPNNYAFALWYAHDSHRTVAWMANRDDLVGYNSSLTLENGNLTLSDSDAQGRIWS
ARINASKGASVGMGLVLLDSGNLVFKTSENIHIVSGRKNICFSQSAVEGDQWFFPKRAFD
WVVLERNAEDVVDKSLLSGVRNDGLQMEAIRRMVKTAFWCIQSRPDERPSMGKVAKMLQG
TLEVPQPPKPNFFVNFLHAGSEVGDPIHELPPPAPLI
Download sequence
Identical sequences PITA_000053208-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]