SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000074302-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000074302-RA
Domain Number 1 Region: 70-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000057
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  PITA_000074302-RA
Domain Number - Region: 114-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0231
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PITA_000074302-RA
Sequence length 177
Comment protein AED:0.08 eAED:0.08 QI:0|0|0|0.66|1|0.66|3|0|177
Sequence
MWNRDWRPIIFLLVVLAVHASYALECQDTRCKSEECDEDGECICKLPVPSSILDGDRLYY
GGKFCDKEQVMCDGTNSFWCEHGGRCNEIIQGENYTCNCPPGFIGEHCEHSGAPCGNMFC
FHQAECIKEDSLCDCPPNWRGNANCSLPTKIGNSSFFLCSFSCLVLAGSGTIPDGIN
Download sequence
Identical sequences PITA_000074302-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]