SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000078194-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000078194-RA
Domain Number 1 Region: 67-155
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000782
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 2 Region: 275-361
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000018
Family Eukaryotic type KH-domain (KH-domain type I) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITA_000078194-RA
Sequence length 406
Comment protein AED:0.12 eAED:0.12 QI:0|0|0|1|1|1|2|0|406
Sequence
MRSKIKVTDIVPGVDDRVIVIFSSSSSDHKEQYGEDCNYENEVEPVCATQDSLLRVHSLI
VQQPSSTNNDIDKKRQHIARLLIADSQIGGLIGKCGNNIQKLRSESGAQIQIHLKDEFPG
CAFSFGEVIVISRDATAVKKALYVVSSFLYKHPPKEQIPWTDILSTTNPTSLVPSGVLAL
FTLPNYVPQRDSLFTHNHSGAPSLGIYAFDHLPTLGEHGSEAVRSSWPLIYNHALPIAPK
SRNSAIEKKLANDGVSPTLEALLQLQVKTSIDNDNDESGICTRLLVSSNHIGCLLSKGGN
IISEMRKHSGANIRTFLKQERPKCASRNEELVQVTGEPTVSRDNTLIQITKKLRDFFFKK
MLDSANNIDTFLPLSSLSSISVPSAIPLSSNYQTRKYDIGLPRGTR
Download sequence
Identical sequences PITA_000078194-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]