SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PITA_000078708-RA from Pinus taeda

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PITA_000078708-RA
Domain Number 1 Region: 186-273
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-19
Family alpha-D-mannose-specific plant lectins 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PITA_000078708-RA
Sequence length 445
Comment protein AED:0.40 eAED:0.57 QI:0|0|0|0.8|0|0.2|5|0|445
Sequence
MVTGNGGRATIDGLGVVVDAWMERCVECWGWITVWISGSQCKEWMQRARQRMEYDGSVGG
RKEQERAVKGTGLAEVVEWHSCQHSRGQLQASLLMDIRMRSGNCMRVQHSLIMDCFILLL
LLLHIKLGDAADTASDHKILGASLRGNESCISKLDKSKLGFFSLNDGNVNKWYVGIWYAM
VAHQIITWVANREKPLQNNSNICNLTENGSLILSYGGSILWSAKGNMKKPSSVAIMDSSN
LVIPNARNMFQILWQSFDHPGNTWLLGMKCEPDVDIVEEPLGSKSRTLLPSDGSRRIRPN
QTKYWEIGVWNGQIFSKIPEMRQNSIYEFSFVDNGSYKHYTYFVKLELTYLSRFDMDKSG
EIRVYVMLTNNEWSMHCLGISAMFMLCVVLMHHATVTMFSSATMCWALSPNIATNVILSS
GQVAVFEKCRYDATMPETGAPSMDL
Download sequence
Identical sequences PITA_000078708-RA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]