SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000001176 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000001176
Domain Number 1 Region: 23-248
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.37e-66
Family Ecto-ART 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000001176   Gene: ENSFALG00000001133   Transcript: ENSFALT00000001182
Sequence length 278
Comment pep:novel scaffold:FicAlb_1.4:JH603567.1:3446:6498:-1 gene:ENSFALG00000001133 transcript:ENSFALT00000001182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLALTLALLPMTVATTAYEVIPLDMALDSFDDQYWGCGPAMKAALPALNRSEFQKNPL
FAKVWQKAVAEWQSWESPVSPLSSSSQAIAIMAYTMNDLYQEFNDEVRMAGRSPQAYRDN
FHFKTLHFLLTDALATLKVKEEQKCRCVYRGVDKYKFKANVGDIVRFGQFASTSVCEDVA
HDFGETTVFVVRTCYGAYIEPFSHFDDEEEVLIPPFEKFKVTEVIEEKKKVEIHLESIGT
YSKYNCEWVNGGSSHMAPCHLGGLLLATTVLAMATGIL
Download sequence
Identical sequences U3JEH2
XP_005062433.1.66865 ENSFALP00000001176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]