SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000001409 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000001409
Domain Number 1 Region: 213-332
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.28e-46
Family MBT repeat 0.0000459
Further Details:      
 
Domain Number 2 Region: 101-210
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.28e-44
Family MBT repeat 0.00000398
Further Details:      
 
Domain Number 3 Region: 317-443
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 8.27e-36
Family MBT repeat 0.0000284
Further Details:      
 
Domain Number 4 Region: 574-647
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.63e-16
Family SAM (sterile alpha motif) domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000001409   Gene: ENSFALG00000001349   Transcript: ENSFALT00000001417
Sequence length 651
Comment pep:novel scaffold:FicAlb_1.4:JH603214.1:7079376:7120688:1 gene:ENSFALG00000001349 transcript:ENSFALT00000001417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQQHRESSGCQVTEAGRPVRRLRRKRRLPLDSEDEEENVYEDESANWAEEKNKSNNMK
SRRNTKPIKQVLPGKKRVWNWSSYLEEEQMPAAPQKLFREYQSFPQGRNGFKVGMKLEGV
DPEHPSRFCVLTVAEVQGYRMRLHFDGYPECYDFWANADSSDIHPVGWCEKTSHKLLPPK
GFKEGEFNWTSYLKNCKAQAAPKSLFKTLSSPVTPSGFRLGMKLEAVDKKNPSLLCVATI
TDVVENRLLIHFDNWDDSYDYWCETSSPYIRPVGYCQETGTPLTTPPGHKDSKAFSWEKY
LEETNSQAAPARAFKLRPPHGFQVNTKLEAVDRRNPILIRVATIVDKDNHRVKIHFDGWD
HHYDFWVDADSPDIHPVGWCDKTGHALQVPLGAEDPEGAVGQACPTPGCQGIGHVRGPRY
GTHYTLVGCPYSDVNLSRENLLQDRLSGERPSPGSSMQKARRLETADPLLGAEESSQGDS
AQSSISFPDSRRKSAPDSEKWCQSSIHTPSEQLGCSHAYIKFQLVKQESNGKGPDLDLQQ
ALHQSIFMPSLASNPTHRLHLFWEQHCRLLPEVSGLTAKQVAKWTVEEVVSFIQRLPGCK
EQASVFREEQIDGEAFLLLKQNDIVKILSIKLGPALKIYNAILMFKSAEDN
Download sequence
Identical sequences U3JF55
ENSFALP00000001409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]