SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000001512 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000001512
Domain Number 1 Region: 31-115
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000135
Family Calmodulin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000001512   Gene: ENSFALG00000001450   Transcript: ENSFALT00000001521
Sequence length 152
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603212.1:2541001:2550666:1 gene:ENSFALG00000001450 transcript:ENSFALT00000001521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RNVAFHHSFQFGLVTMVMRAQQKSWLCKSLKSEEFLCDPKFSNEKDLEEKLAVFKEKYME
FDLNNQGEIDLMSVKRMMEKLGAPKTHLELKRMISEVTGGVSDTISYQDFVNVMLGKRSA
VLKLVMMFEGKANESNPKPSGPPPERDIASLP
Download sequence
Identical sequences U3JFF8
ENSFALP00000001512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]