SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000001824 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000001824
Domain Number 1 Region: 24-249
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.92e-43
Family Ecto-ART 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000001824   Gene: ENSFALG00000001752   Transcript: ENSFALT00000001834
Sequence length 329
Comment pep:novel scaffold:FicAlb_1.4:JH603557.1:67551:78385:1 gene:ENSFALG00000001752 transcript:ENSFALT00000001834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLALTLALLPMTVATTAYEVKPLDMAPDSFDDQYRGCGPAMKAALPALNHSEFQKNCF
FAKGWEKAVAMWQRVGSPVSPLSSSAQAIAIVSYNMIYVHEEFNDETSVAGRSPQEYRDN
FNYKTLHFLLTDALATLRAAQGQQCRCVTWAAPQYKFKANVGDIVRLGQFVLSWPCRGGT
RSFFTPTMFQVQTCHGVGIQAFIDQPRSETLLIPPFEKFRVTNVIDDGEKEEIHLDSIGT
YSKYNCEWLTGGSVSRAPTISEDSSWSSQPWQWPQGSSEPQGPEDICGHCYNQDSQRNKS
TRTTMATTATMAALATMASMWSLRPPLAL
Download sequence
Identical sequences U3JGC0
XP_016160947.1.66865 ENSFALP00000001824 ENSFALP00000001825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]