SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000002380 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000002380
Domain Number 1 Region: 585-806
Classification Level Classification E-value
Superfamily Ras GEF 3.79e-33
Family Ras GEF 0.0062
Further Details:      
 
Domain Number 2 Region: 211-327
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-25
Family SH2 domain 0.00053
Further Details:      
 
Domain Number 3 Region: 4-63
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000147
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000002380   Gene: ENSFALG00000002288   Transcript: ENSFALT00000002392
Sequence length 895
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603197.1:38577:122109:-1 gene:ENSFALG00000002288 transcript:ENSFALT00000002392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYLPISNWLTQLGLAEYCTLFEQYDGIEDLFHLTEVDLRKLGIENQGHRTHLISNILLL
QEVKQKREPKMIAAGKLSSLPRSSPVNHQFSLASSMDLLTTKPSTIEHRSNSFQGISIHG
TLPRKKKGTVPSRSCDMFSHMGTLPYIRARQQPPLIQDIIEEYPPENGKGSKLLDRDQNI
LDPALEYVKFSRERQVMDNSPEKLKKELEEELQLSSEDLRSHAWYHGRIPRQVAEGLVQR
DGDFLIRDSLSSPGNFVLTCQWKNTPQHFKINKTVLRLNEAYCRVQYQFELESFDTVPGL
VRYYVGNRTPISKQSGAIIFQPINRTVPLRCLEEKYGVTPVQQKEPSTPEGKTETAKGLS
PGISSMQSPEQSIPRGNLWRNKEKSGSQPASLDHVLEKRFPLKAHQSESYLLIGSRHPSR
LPEADANSCPSSPAFRTGSEPSLSPTVVQKVILESQLGEALRGSDSQLCLKPPPKPCKAP
LIKPPDSPLASHSSEGHYCELNPARHPTAAKQHLCQKNSYVEHLTQKERATFRNSETSYL
ILDDDPTTSPADPSEASTQMAEEDSIFSAPVYEKVSSFKPNDFESKLLPPENKPLETSML
RRVKELFTNNNPKMIAQHILRMDCKVARIVEVSEEMRRNMGGNSGLELITLPYGHQLRLD
LIERHNTMAIGIAVDILGCTGNVEERAATLNRIIQVAVELKESLGDLYGFSAIMKALEMP
QVSRLEQTWTALRHCYTQTAIMYEKQLKPSCKALHEGQDEWTKTISAPQNNITVPLLMPL
VTLLERQAVVFEGVELWESSDQSGEIMLRHLGTARLLAQHAETFRLTAERLLQGFQPDEE
LSEIFKTEFQMRLLWGSKGAQVNQSERYEKFNRILTALSRKLEPPPVKLVEQLSI
Download sequence
Identical sequences U3JHX6
ENSFALP00000002380 XP_005050432.1.66865 XP_005050433.1.66865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]