SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000002411 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000002411
Domain Number 1 Region: 61-140
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.34e-20
Family SAM (sterile alpha motif) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000002411   Gene: ENSFALG00000002318   Transcript: ENSFALT00000002423
Sequence length 153
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603185.1:3811128:3882647:-1 gene:ENSFALG00000002318 transcript:ENSFALT00000002423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFPAIHCNLNPNGIDHPVPTEGINLQLEGEGVDSPTVKSTGAPKGPETKDTPKRQVEPEI
SKSGTVKLTKPVALWTQQDVCKWLKKHCPNQYQIYSESFKQHDITGRALLRLTDKKLERM
GIAQESLRQHILQQVLQLKVREEVRNLQLLTQG
Download sequence
Identical sequences U3JI07
ENSFALP00000002411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]