SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFALP00000002734 from Ficedula albicollis 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFALP00000002734
Domain Number 1 Region: 268-393
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.49e-43
Family ets domain 0.00035
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-26
Family Pointed domain 0.0000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFALP00000002734   Gene: ENSFALG00000002616   Transcript: ENSFALT00000002746
Sequence length 406
Comment pep:known_by_projection scaffold:FicAlb_1.4:JH603306.1:305103:336570:-1 gene:ENSFALG00000002616 transcript:ENSFALT00000002746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLFHGPSYIDLQPVYWSREDVAQWLRWAEKEFSLRPIESNTFEMNGKALLLLTKEDFRYR
SPHSGDVLYELLQHILKQRKARMLFTPFFHPGNSIHAQPEVILHQNHDEDSFVQRPSRPS
AEAVHHNPPTIELLHRSRSPITNNHRPSPDPDQRPLKSPMDNAFRRLSPADRVPGTRHQH
ENNQQEPYPLSVSPIENNHCPPPSEMLQKPSSPRQENTRVIQLMPSPIMHPLILNPRHTD
FKPPRLSEDGLHREVKPINLSHREELAYMNHIMVSVSPPEDHAMPIGRIADCRLLWDYVY
QLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNI
IRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQELDEQIYQEDEC
Download sequence
Identical sequences U3JIY0
ENSFALP00000002734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]